PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00032g23003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 214aa    MW: 24390.9 Da    PI: 9.828
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00032g23003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.94.9e-221057249
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                              +ie k   qvtfskRr g++KKA+EL++LC++e+a+i+fs+  k+y +
  Peinf101Scf00032g23003.1 10 KIEMKNHLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPARKIYSF 57
                              68889999*************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.67161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-27174IPR002100Transcription factor, MADS-box
CDDcd002652.40E-33271No hitNo description
PRINTSPR004043.5E-18323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGRQKIKIAK IEMKNHLQVT FSKRRSGLFK KASELCTLCG VEIAIIVFSP ARKIYSFGHP  60
NVESIIDRFL KRNSHYPISN NTLHLVDAHR NASIIELNLQ LTQVLAELEV EKKRGESFDH  120
MRKTSESQYW WEAPISKLAL HELEQLKDSM EDLKKNVINQ TSKVMVETAN NSSSFLGVNG  180
NIGIFDNYDI KPARTIVTSN NLHNHNFGFG SGFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S8e-14182182Myocyte-specific enhancer factor 2B
1tqe_R8e-14182182Myocyte-specific enhancer factor 2B
1tqe_Q8e-14182182Myocyte-specific enhancer factor 2B
1tqe_P8e-14182182Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016448849.11e-129PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK29e-59AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLM1DUY31e-112M1DUY3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000948161e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-60AGAMOUS-like 62